Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
TAT - HA2 Fusion Peptide
RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG
| Overview | |
|---|---|
| Description | This sequence is amino acids 1 to 20 of influenza A virus hemagglutinin protein (HA2) connected to a 10 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). TAT-HA2 is capable of being used as a large macromolecule drug delivery peptide. The TAT PTD binds to the cell surface and penetrates the membrane via lipid raft-dependent macropinocytosis. Endosomal escape and transduction of the fusion peptide are enhanced by the HA2 domain, which is a pH-sensitive lipid membrane destabilizing sequence. |
| Sequence | RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG |
| Sequence (3 Letter) | H - Arg - Arg - Arg - Gln - Arg - Arg - Lys - Lys - Arg - Gly - Gly - Asp - Ile - Met - Gly - Glu - Trp - Gly - Asn - Glu - Ile - Phe - Gly - Ala - Ile - Ala - Gly - Phe - Leu - Gly - OH |
| Molecular Weight | 3433 |
| Properties | |
| Purity | % Peak Area By HPLC ≥ 95% |
| Storage | -20 °C |
Wadia, J. et al. Nature Med 10, 310 (2004).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.