
Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Description | This sequence is amino acids 1 to 20 of influenza A virus hemagglutinin protein (HA2) connected to a 10 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). TAT-HA2 is capable of being used as a large macromolecule drug delivery peptide. The TAT PTD binds to the cell surface and penetrates the membrane via lipid raft-dependent macropinocytosis. Endosomal escape and transduction of the fusion peptide are enhanced by the HA2 domain, which is a pH-sensitive lipid membrane destabilizing sequence. |
Sequence | RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG |
Sequence (3 Letter) | H - Arg - Arg - Arg - Gln - Arg - Arg - Lys - Lys - Arg - Gly - Gly - Asp - Ile - Met - Gly - Glu - Trp - Gly - Asn - Glu - Ile - Phe - Gly - Ala - Ile - Ala - Gly - Phe - Leu - Gly - OH |
Molecular Weight | 3433 |
Properties | |
Purity | % Peak Area By HPLC ≥ 95% |
Storage | -20 °C |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.