
Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Description | Beclin-1 peptide is the HIV-1 Nef binding portion of full-length human Beclin-1 protein (amino acids 267-299). Beclin-1 protein is an autophagy inducing agent that may trigger cellular adaptation, survival or cell death. When conjugated to the cell-permeable peptide, it can successfully enter cells and induce autophagy. Tat-Beclin-1, scrambled will not induce autophagy and can be used as a negative control. RELATED PRODUCTS:Tat-Beclin-1, Cat# 65467Beclin-1, Cat# 65466 |
Sequence | YGRKKRRQRRRGGVGNDFFINHETTGFATEW |
Sequence (3 Letter) | Tyr - Gly - Arg - Lys - Lys - Arg - Arg - Gln - Arg - Arg - Arg - Gly - Gly - Val - Gly - Asn - His - Phe - Phe - Ile - Asn - His - Ser - Thr - Thr - Gly - Phe - Ala - Thr - Gln - Trp - OH |
Molecular Weight | 3741.1 |
Properties | |
Purity | % Peak Area By HPLC ≥ 95% |
Storage | -20 °C |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.