Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!
Product Code: 3420-0100

Price: $171.00

Available Options

* Package Size:
- +
Overview
Description Beclin-1 peptide is the HIV-1 Nef binding portion of full-length human Beclin-1 protein (amino acids 267-299). Beclin-1 protein is an autophagy inducing agent that may trigger cellular adaptation, survival or cell death. When conjugated to the cell-permeable peptide, it can successfully enter cells and induce autophagy. Tat-Beclin-1, scrambled will not induce autophagy and can be used as a negative control. RELATED PRODUCTS:Tat-Beclin-1, Cat# 65467Beclin-1, Cat# 65466
Sequence YGRKKRRQRRRGGVGNDFFINHETTGFATEW
Sequence (3 Letter) Tyr - Gly - Arg - Lys - Lys - Arg - Arg - Gln - Arg - Arg - Arg - Gly - Gly - Val - Gly - Asn - His - Phe - Phe - Ile - Asn - His - Ser - Thr - Thr - Gly - Phe - Ala - Thr - Gln - Trp - OH
Molecular Weight 3741.1
Properties
Purity % Peak Area By HPLC ≥ 95%
Storage -20 °C
Shoji-Kawata, S. Nature 494, 201-209 (2013); Marquez, RT. Am J Cancer Res 2 (2), 214–221 (2012).

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.