Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Chimeric Rabies Virus Glycoprotein Fragment (RVG - 9R)
YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
| Overview | |
|---|---|
| Description | This chimeric peptide is a fragment derived from rabies virus glycoprotein (RVG). Because neurotropic viruses cross the blood-brain barrier to infect brain cells, the same strategy may be used to enter the central nervous system and deliver siRNA to the brain. To enable siRNA binding, this chimeric peptide was synthesized by adding nonamer arginine residues at the carboxy terminus of RVG. This RVG-9R peptide was able to bind and transduce siRNA to neuronal cells in vitro, resulting in efficient gene silencing. After intravenous injection into mice, RVG-9R delivered siRNA to the neuronal cells, resulting in specific gene silencing within the brain. RVG-9R provides a safe and noninvasive approach for the delivery of siRNA and potentially other therapeutic molecules across the blood €“brain barrier. |
| Sequence | YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR |
| Sequence (3 Letter) | H - Tyr - Thr - Ile - Trp - Met - Pro - Glu - Asn - Pro - Arg - Pro - Gly - Thr - Pro - Cys - Asp - Ile - Phe - Thr - Asn - Ser - Arg - Gly - Lys - Arg - Ala - Ser - Asn - Gly - Gly - Gly - Gly - Arg - Arg - Arg - Arg - Arg - Arg - Arg - Arg - Arg - OH |
| Molecular Weight | 4843.5 |
| Properties | |
| Purity | % Peak Area By HPLC ≥ 95% |
| Storage | -20 °C |
Kumar, P. et al. Nature 448, 39 (2007).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.