Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
RYR2 (2460 - 2495)
GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP
| Overview | |
|---|---|
| Description | This is amino acids 2460 to 2495 fragment of cardiac ryanodine receptor (RyR2). RyR2 controls calcium release from the sarcoplasmic reticulum, which begins muscle contraction. Mutated RyR2 is associated to ventricular tachycardia (VT) and sudden death. |
| Sequence | GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP |
| Sequence (3 Letter) | H - Gly - Phe - Cys - Pro - Asp - His - Lys - Ala - Ala - Met - Val - Leu - Phe - Leu - Asp - Arg - Val - Tyr - Gly - Ile - Glu - Val - Gln - Asp - Phe - Leu - Leu - His - Leu - Leu - Glu - Val - Gly - Phe - Leu - Pro - OH |
| Molecular Weight | 4103.9 |
| Properties | |
| Purity | % Peak Area By HPLC ≥ 95% |
| Storage | -20 °C |
Jiang, D. et al. Proc Natl Acad Sci U S A 101, 35 (2004).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.