Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

RYR2 (2460 - 2495)
GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP

Product Code: 3176-0100

Price: $252.00

Available Options

* Package Size:
- +
Overview
Description This is amino acids 2460 to 2495 fragment of cardiac ryanodine receptor (RyR2). RyR2 controls calcium release from the sarcoplasmic reticulum, which begins muscle contraction. Mutated RyR2 is associated to ventricular tachycardia (VT) and sudden death.
Sequence GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP
Sequence (3 Letter) H - Gly - Phe - Cys - Pro - Asp - His - Lys - Ala - Ala - Met - Val - Leu - Phe - Leu - Asp - Arg - Val - Tyr - Gly - Ile - Glu - Val - Gln - Asp - Phe - Leu - Leu - His - Leu - Leu - Glu - Val - Gly - Phe - Leu - Pro - OH
Molecular Weight 4103.9
Properties
Purity % Peak Area By HPLC ≥ 95%
Storage -20 °C
Jiang, D. et al. Proc Natl Acad Sci U S A 101, 35 (2004).

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.