Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!
Product Code: 3351-0050

Price: $257.00

Available Options

* Package Size:
- +
Overview
Description

BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. Further, sequence identity between rat and mouse BNP prohormones is found to be more conserved in the N-terminal portion of the prohormone than in the C-terminal BNP-45 (88% versus 64%). The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence. Comparing the amino acid sequence surrounding the proteolytic processing site for BNP-32 in human, pig, and dog BNP with the corresponding site for BNP-45 in the rat and mouse sequence we find that all of the secreted BNP hormones have an N-terminal serine preceded by an arginine in the prohormone sequence, and the mouse and rat sequences are highly conserved at the putative scissile bond (LKRVLR-SQ). Further comparative sequence analysis indicates that an arginine being present at position -4 relative to the scissile (R-S) bond in all mammalian BNP precursors. Thus, processing of BNP prohormones to both BNP-45 in rodents and BNP-32 in higher mammals appears to require a protease with a conserved recognition sequence (RXXR-S). Also, the conserved sequences in the BNP prohormones matches the consensus cleavage site for human furin, a calcium-dependent serine endoprotease expressed in mouse heart, and possibly having a role in processing BNP precursors.

Sequence SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23-39)
Sequence (3 Letter) H - Ser - Gln - Asp - Ser - Ala - Phe - Arg - Ile - Gln - Glu - Arg - Leu - Arg - Asn - Ser - Lys - Met - Ala - His - Ser - Ser - Ser - Cys - Phe - Gly - Gln - Lys - Ile - Asp - Arg - Ile - Gly - Ala - Val - Ser - Arg - Leu - Gly - Cys - Asp - Gly - Leu -
Molecular Weight 5040.8
Properties
Purity % Peak Area By HPLC ≥ 95%
Storage -20 °C

Steinhelper, ME. Circ. Res. 72: 984-992. (1993).

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.