Call Now: +1 858 800 3101 Email: info@innopep.com
| Overview | |
|---|---|
| Description | Prostatic Acid Phosphatase (248-286), PAP (248-286) peptide is a semen-derived enhancer of viral infection (SEVI) factor found in semen. This peptide greatly increases HIV infection through enhanced virion attachment to target cells. |
| Sequence | GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY |
| Sequence (3 Letter) | H-Gly-Ile-His-Lys-Gln-Lys-Glu-Lys-Ser-Arg-Leu-Gln-Gly-Gly-Val-Leu-Val-Asn-Glu-Ile-Leu-Asn-His-Met-Lys-Arg-Ala-Thr-Gln-Ile-Pro-Ser-Tyr-Lys-Lys-Leu-Ile-Met-Tyr-OH |
| Molecular Weight | 4551.5 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.