Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
PDKtide, biotin labeled
| Overview | |
|---|---|
| Description | This 39-mer peptide is a biotinylated substrate for phosphatidylinositide-dependent kinase 1 (PDK1). Biotin is linked to the N-terminus of the peptide through an LC (6-carbon linker). PDK1 has a C-terminal pleckstrin homology domain that aims at phosphoinositide lipids on the plasma membrane. It is central to the activating protein kinase B, a protein that mediates biological responses to insulin and growth factors. |
| Sequence | Biotin-Ahx[protein fragment, 39 aa] |
| Sequence (3 Letter) | Biotin-Ahx-Lys-Thr-Phe-Cys-Gly-Thr-Pro-Glu-Tyr-Leu-Ala-Pro-Glu-Val-Arg-Arg-Glu-Pro-Arg-Ile-Leu-Ser-Glu-Glu-Glu-Gln-Glu-Met-Phe-Arg-Asp-Phe-Asp-Tyr-Ile-Ala-Asp-Trp-Cys-OH |
| Molecular Weight | 5110.9 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
Berggreen, C. et al. Am J Physiol Endocrinol Metab 296, 635 (2009); Scheid, M. et al. Mol Cell Biol 25, 6 (2005).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.