Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
LL - 37 pentamide
| Overview | |
|---|---|
| Description | This synthetic peptide is a modification of the LL-37 cathelicidin peptide in which each aspartic acid of LL-37 is replaced by an asparagine, and glutamic acid by glutamine. The anti-staphylococcal activity LL-37 pentamide is greater than that of LL-37 because multiple acidic residues of human LL-37 reduce its efficacy against Staphylococci. |
| Sequence | LLGNFFRKSKQKIGKQFKRIVQRIKNFFRNLVPRTQS |
| Sequence (3 Letter) | H-Leu-Leu-Gly-Asn-Phe-Phe-Arg-Lys-Ser-Lys-Gln-Lys-Ile-Gly-Lys-Gln-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asn-Phe-Phe-Arg-Asn-Leu-Val-Pro-Arg-Thr-Gln-Ser-OH |
| Molecular Weight | 4522.4 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
Zhao, C. et al. Antimicrob. Agents Chemother. 45, 2695 (2001).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.