Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!
Product Code: 1237-005

Price: $156.00

Available Options

* Package Size:
- +
Overview
Description This is fragment 8-37 from LL-37, it exhibits enhanced antimicrobial activity. Antimicrobial peptide LL-37, belonging to the cathelicidin family, is the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense (innate immunity) against local infection and systemic invasion of pathogens at sites of inflammation and wounds.
Sequence KSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Molecular Weight 3644.3
Properties
Purity > 95% By HPLC
Storage Store at -20 °C, cap vial tightly at all times.

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.