Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Elafin
| Overview | |
|---|---|
| Description | This is a fragment of the elafin (elastase-specific inhibitor), an antiproteinase and antimicrobial (gram-positive and gram-negative respiratory pathogens) molecule that is expressed at epithelial sites. Elafin is a potent inhibitor of HNE and proteinase 3 produced in the skin, and in the airways , which is up-regulated in response to early inflammatory cytokines such as TNF and IL-1. Elafin, along with SLPI, also shares characteristics with antimicrobial defensin-like molecules in being a low molecular weight cationic peptide with the ability to eliminate pulmonary pathogens. |
| Sequence | AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53) |
| Sequence (3 Letter) | H-Ala-Gln-Glu-Pro-Val-Lys-Gly-Pro-Val-Ser-Thr-Lys-Pro-Gly-Ser-Cys-Pro-Ile-Ile-Leu-Ile-Arg-Cys-Ala-Met-Leu-Asn-Pro-Pro-Asn-Arg-Cys-Leu-Lys-Asp-Thr-Asp-Cys-Pro-Gly-Ile-Lys-Lys-Cys-Cys-Glu-Gly-Ser-Cys-Gly-Met-Ala-Cys-Phe-Val-Pro-Gln-OH (Disufide bonds bet |
| Molecular Weight | 5999.3 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
King, A. et al. J. Clin. Endo. Metab. 88, 4426 (2003); Wiedow, O. et al . J. Biol. Chem. 265, 14791 (1990); Wiedow, O. et al. Biochem. Biophys. Res. Commun. 174, 6 (1991); Tremblay, G. et al. Am. J. Respir. Crit. Care Med. 154, 1092 (1996); Simpson, AJ. et al. J. Immunol. 167, 1778 (2001).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.