Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

Elafin

Product Code: 1214-001

Price: $210.00

Available Options

* Package Size:
- +
Overview
Description This is a fragment of the elafin (elastase-specific inhibitor), an antiproteinase and antimicrobial (gram-positive and gram-negative respiratory pathogens) molecule that is expressed at epithelial sites. Elafin is a potent inhibitor of HNE and proteinase 3 produced in the skin, and in the airways , which is up-regulated in response to early inflammatory cytokines such as TNF and IL-1. Elafin, along with SLPI, also shares characteristics with antimicrobial defensin-like molecules in being a low molecular weight cationic peptide with the ability to eliminate pulmonary pathogens.
Sequence AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53)
Sequence (3 Letter) H-Ala-Gln-Glu-Pro-Val-Lys-Gly-Pro-Val-Ser-Thr-Lys-Pro-Gly-Ser-Cys-Pro-Ile-Ile-Leu-Ile-Arg-Cys-Ala-Met-Leu-Asn-Pro-Pro-Asn-Arg-Cys-Leu-Lys-Asp-Thr-Asp-Cys-Pro-Gly-Ile-Lys-Lys-Cys-Cys-Glu-Gly-Ser-Cys-Gly-Met-Ala-Cys-Phe-Val-Pro-Gln-OH (Disufide bonds bet
Molecular Weight 5999.3
Properties
Purity > 95% By HPLC
Storage Store at -20 °C, cap vial tightly at all times.
King, A. et al. J. Clin. Endo. Metab. 88, 4426 (2003); Wiedow, O. et al . J. Biol. Chem. 265, 14791 (1990); Wiedow, O. et al. Biochem. Biophys. Res. Commun. 174, 6 (1991); Tremblay, G. et al. Am. J. Respir. Crit. Care Med. 154, 1092 (1996); Simpson, AJ. et al. J. Immunol. 167, 1778 (2001).

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.