Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

CAP - 18, rabbit

Product Code: 1218-005

Price: $197.00

Available Options

* Package Size:
- +
Overview
Description This 37 residue peptide is a very effective antimicrobial agent in rabbits. The CAP-18 cathelicidin-derived peptide kills bacteria by disrupting the bacterial membrane. It has a potential for the treatment of bacterial infections in normal and immunocompromised persons and individuals with cystic fibrosis. In experiments it demonstrates the greatest activity against over 20 clinical strains of Pseudomonas aeruginosa. Homologs of CAP18 in other species include humans (FALL39/LL37), mice (mCRAMP), rats (rCRAMP), and sheep (SMAP29 and SMAP34).
Sequence GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
Sequence (3 Letter) H-Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-Gly-Leu-Leu-Pro-Lys-Leu-Ala-Pro-Arg-Thr-Asp-Tyr-OH
Molecular Weight 4433.5
Properties
Purity > 95% By HPLC
Storage Store at -20 °C, cap vial tightly at all times.
Travis, S et al. Infect. Immun. 68, 2748 (2000).

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.