Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!
Product Code: 3432-0050

Price: $284.00

Available Options

* Package Size:
- +
Overview
Description Rat adrenomedullin, rADM, (1-50) and its C-terminal rADM (11-50) induce a dose-dependent and endothelium-independent vasodilation on the arterial mesenteric vasculature.
Sequence YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: 14-19)
Sequence (3 Letter) H - Tyr - Arg - Gln - Ser - Met - Asn - Gln - Gly - Ser - Arg - Ser - Thr - Gly - Cys - Arg - Phe - Gly - Thr - Cys - Thr - Met - Gln - Lys - Leu - Ala - His - Gln - Ile - Tyr - Gln - Phe - Thr - Asp - Lys - Asp - Lys - Asp - Gly - Met - Ala - Pro - Arg -
Molecular Weight 5729.5
Properties
Purity % Peak Area By HPLC ≥ 95%
Storage -20 °C
Ref: Belloni, AS. et al. Life Sci. 63, 2313 (1998); Sone, M. et al. Peptides 18, 1125 (1997).

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.