Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Description | Rat adrenomedullin, rADM, (1-50) and its C-terminal rADM (11-50) induce a dose-dependent and endothelium-independent vasodilation on the arterial mesenteric vasculature. |
Sequence | YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: 14-19) |
Sequence (3 Letter) | H - Tyr - Arg - Gln - Ser - Met - Asn - Gln - Gly - Ser - Arg - Ser - Thr - Gly - Cys - Arg - Phe - Gly - Thr - Cys - Thr - Met - Gln - Lys - Leu - Ala - His - Gln - Ile - Tyr - Gln - Phe - Thr - Asp - Lys - Asp - Lys - Asp - Gly - Met - Ala - Pro - Arg - |
Molecular Weight | 5729.5 |
Properties | |
Purity | % Peak Area By HPLC ≥ 95% |
Storage | -20 °C |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.