Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Description | This pool includes 16 peptides derived from a peptide scan (15mers with 11 aa overlap) through the entire Uncharacterized protein 14 (Protein ID: P0DTD3) of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) for T cell assays. |
Sequence | MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVMLLLLCCCLTD |
Properties | |
Purity | Crude |
Solubility | Dissolve in a minimum amount of pure DMSO (approx. 40 µl) and dilute with PBS buffer to the final concentration. Please note that the final concentration of DMSO must be below 1 % (v/v) to avoid toxicity in the biological system. |
Storage | Store at -20°C. |
Note | The peptides of this product are supplied as trifluoroacetate salts |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.