Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!
Product Code: N4262

Price: $253.00

Available Options

* Package Size:
- +
Overview
Description This pool includes 28 peptides derived from a peptide scan (15mers with 11 aa overlap) through the entire Non-structural protein 7A (Protein ID: P0DTC7) of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) for T cell assays.
Sequence MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE
Properties
Purity Crude
Solubility Dissolve in a minimum amount of pure DMSO (approx. 40 µl) and dilute with PBS buffer to the final concentration. Please note that the final concentration of DMSO must be below 1 % (v/v) to avoid toxicity in the biological system
Storage Store at -20°C.
Note The peptides of this product are supplied as trifluoroacetate salts

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.