Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
SARS-CoV-2 ORF10
| Overview | |
|---|---|
| Description | This pool includes 7 peptides derived from a peptide scan (15mers with 11 aa overlap) through the entire ORF10 Protein (Protein ID: A0A663DJA2) of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) for T cell assays (e.g. ELISPOT). |
| Sequence | MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT |
| Properties | |
| Purity | Crude |
| Solubility | Dissolve in a minimum amount of pure DMSO (approx. 40 µl) and dilute with PBS buffer to the final concentration. Please note that the final concentration of DMSO must be below 1 % (v/v) to avoid toxicity in the biological system. |
| Storage | Store at -20°C. |
| Note | The peptides of this product are supplied as trifluoroacetate salts |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.