Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Growth Hormone Releasing Factor (GHRF) (1-44), human
| Overview | |
|---|---|
| Synonyms | Growth Hormone Releasing FactorGHRF (1-44), human |
| Description | Growth hormone-releasing factor (GHRF) is a hypothalamic peptide which positively regulates the synthesis and secretion of growth hormone in the anterior pituitary. The amino-acid sequence of a 43-residue GHRF peptide isolated from rat hypothalamus was recently determined. Immunocytochemical techniques have been used to localize GHRF-containing cell bodies and nerve fibres largely to the medial-basal region of the rat hypothalamus. The rat has also been used extensively as an animal model to study the effects of GHRF on growth hormone synthesis and secretion and on somatic growth. |
| Cas No | 83930-13-6 |
| Sequence | {TYR}{ALA}{ASP}{ALA}{ILE}{PHE}{THR}{ASN}{SER}{TYR}{ARG}{LYS}{VAL}{LEU}{GLY}{GLN}{LEU}{SER}{ALA}{ARG}{LYS}{LEU}{LEU}{GLN}{ASP}{ILE}{MET}{SER}{ARG}{GLN}{GLN}{GLY}{GLU}{SER}{ASN}{GLN}{GLU}{ARG}{GLY}{ALA}{ARG}{ALA}{ARG}{LEU}-NH2 |
| Sequence Shortening | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 |
| Molecular Formula | C215H358N72O66S1 |
| C Terminal | NH2 |
| Molecular Weight | 5039.8 |
| Properties | |
| Purity | > 95% |
| Gmp Flag | 0 |
| Storage | Store at -20°C. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.