 
					
				
Call Now: +1 858 800 3101 Email: info@innopep.com
| Overview | |
|---|---|
| Synonyms | Glucagon-Like PeptideI; Glucagon-Like Peptide 1; Glucagon-Like Peptide1; GLP-I; GLPI; GLP-1; GLP1; GCG peptide | 
| Description | GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells. It is a potent insulinotropic hormone. | 
| Sequence | {HIS}{ALA}{GLU}{GLY}{THR}{PHE}{THR}{SER}{ASP}{VAL}{SER}{SER}{TYR}{LEU}{GLU}{GLY}{GLN}{ALA}{ALA}{LYS}{GLU}{PHE}{ILE}{ALA}{TRP}{LEU}{VAL}{LYS}{GLY}{ARG}{GLY} | 
| Sequence Shortening | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG | 
| Molecular Formula | C151H228N40O47 | 
| Molecular Weight | 3355.68 | 
| Properties | |
| Purity | > 95% | 
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. | 
| Gmp Flag | 0 | 
| Storage | Store at -20°C. Keep tightly closed. Store in a cool dry place. | 
| Note | Potent Insulin secretagogue. | 
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.