Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Glucagon-Like Peptide (GLP) I (7-36), amide, human
| Overview | |
|---|---|
| Synonyms | GLP-1 (7-36), amide, humanGlucagon Like PeptideI; Glucagon Like Peptide 1; Glucagon Like Peptide1; GLP-I; GLPI; GLP-1; GLP1 |
| Description | Glucagon-Like Peptide I (7-36) (GLP)-1 (7-36)-NH2 is a peptide found in the mucosal endocrine cells of the intestine, and plasma levels of Glucagon-Like Peptide I (7-36)-NH2 immunoreactivity show a rise after the ingestion of a fat or mixed-component meal. The effects of physiological infusion of Glucagon-Like Peptide I (7-36)-NH2 on a submaximal gastric acid secretion in healthy volunteers at a rate known to mimic the observed postprandial rise in plasma concentrations. Some results suggest a novel role for Glucagon-Like Peptide I (7-36)-NH2 as a physiological inhibitor of gastric acid secretion in humans. |
| Cas No | 107444-51-9 |
| Sequence | {HIS}{ALA}{GLU}{GLY}{THR}{PHE}{THR}{SER}{ASP}{VAL}{SER}{SER}{TYR}{LEU}{GLU}{GLY}{GLN}{ALA}{ALA}{LYS}{GLU}{PHE}{ILE}{ALA}{TRP}{LEU}{VAL}{LYS}{GLY}{ARG}-NH2 |
| Sequence Shortening | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Molecular Formula | C149H226N40O45 |
| C Terminal | NH2 |
| Molecular Weight | 3297.5 |
| Properties | |
| Purity | > 95% |
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. |
| Gmp Flag | 0 |
| Storage | Store at -20°C. Keep tightly closed. Store in a cool dry place. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.