
Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Description | Gastrin-releasing peptide (GRP) is released by the post-ganglionic fibres of the vagus nerve, which innervate the G cells of the stomach and stimulate them to release gastrin. GRP can directly stimulate pepsinogen release from chief cells by a specific GRP receptor that mobilizes intracellular calcium. Gastrin-releasing peptide has a prominent role as a tumor marker in the diagnosis of small-cell lung carcinoma. |
Cas No | 93755-85-2 |
Sequence | {VAL}{PRO}{LEU}{PRO}{ALA}{GLY}{GLY}{GLY}{THR}{VAL}{LEU}{THR}{LYS}{MET}{TYR}{PRO}{ARG}{GLY}{ASN}{HIS}{TRP}{ALA}{VAL}{GLY}{HIS}{LEU}{MET}-NH2 |
Sequence Shortening | VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2 |
Molecular Formula | C130H204N38O31S2 |
C Terminal | NH2 |
Molecular Weight | 2859.3 |
Properties | |
Purity | > 95% |
Solubility | The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. |
Gmp Flag | 0 |
Storage | Store the peptide at -20°C. Keep container tightly closed. |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.