Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Exendin-4
| Overview | |
|---|---|
| Synonyms | Exendin4exenatide; Byetta |
| Description | Exendin-4 is a 39-amino acid peptide amide. Exendin-4, like Exendin-3, stimulates an increase in acinar cAMP without stimulating the release of amylase. Exendin-4 is a long-acting potent agonist of the glucagon-like peptide 1 (GLP-1). Exendin-4 is the active component of Byetta (exenatide) injection, which may improve glycemic control in people with type 2 diabetes mellitus and has the potential to reduce plasma glucose at least partly by a delay in gastric emptying as well as by reducing calorie intake. Exendin-4 enhances glucose-dependent insulin secretion by the pancreatic β-cell and suppresses inappropriately elevated glucagon secretion. |
| Cas No | 141758-74-9 |
| Sequence | {HIS}{GLY}{GLU}{GLY}{THR}{PHE}{THR}{SER}{ASP}{LEU}{SER}{LYS}{GLN}{MET}{GLU}{GLU}{GLU}{ALA}{VAL}{ARG}{LEU}{PHE}{ILE}{GLU}{TRP}{LEU}{LYS}{ASN}{GLY}{GLY}{PRO}{SER}{SER}{GLY}{ALA}{PRO}{PRO}{PRO}{SER}-NH2 |
| Sequence Shortening | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
| Molecular Formula | C184H282N50O60S |
| C Terminal | NH2 |
| Molecular Weight | 4186.66 |
| Properties | |
| Purity | > 95% |
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. |
| Gmp Flag | 0 |
| Storage | Store the peptide at -20°C. |
| Note | This peptide interacts interacts with exendin receptor to increase pancreatic acinar cAMP. It has no secretagogue activity and does not bind to VIP receptors. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.