Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Cecropin B
| Overview | |
|---|---|
| Description | Cecropins are produced by insects, particularly under conditions of infection. Cecropins are bioactive peptides that interact with membranes and form transmembrane channels that allow the free flow of electrolytes, metabolites, and water across the phospholipid bilayers. Anti-cecropin B is useful for the detection of cecropin B in various immunological assays. Cecropin B has been modified in some instances by substituting a single amino acid to render the molecule less susceptible to proteolytic cleavage. |
| Cas No | 80451-05-4 |
| Sequence | {LYS}{TRP}{LYS}{VAL}{PHE}{LYS}{LYS}{ILE}{GLU}{LYS}{MET}{GLY}{ARG}{ASN}{ILE}{ARG}{ASN}{GLY}{ILE}{VAL}{LYS}{ALA}{GLY}{PRO}{ALA}{ILE}{ALA}{VAL}{LEU}{GLY}{GLU}{ALA}{LYS}{ALA}{LEU}-NH2 |
| Sequence Shortening | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2 |
| Molecular Formula | C176H302N52O41S1 |
| C Terminal | NH2 |
| Molecular Weight | 3834.7 |
| Properties | |
| Purity | > 95% |
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. |
| Gmp Flag | 0 |
| Storage | The peptide may be stored at 4°C for short period. For long-term storage, store at -20°C. Aliquots remain stable for at least 24 months at -20°C. |
| Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.