Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Calcitonin, salmon
| Overview | |
|---|---|
| Synonyms | Thyrocalcitonin |
| Description | Calcitonin (salmon) is an hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. Calcitonin contains a single disulfide bond, which causes the amino terminus to assume the shape of a ring. Alternative splicing of the calcitonin pre-mRNA can yield a mRNA encoding calcitonin gene-related peptide; that peptide appears to function in the nervous and vascular systems. The calcitonin receptor has been cloned and shown to be a member of the seven-transmembrane, G protein-coupled receptor family. |
| Cas No | 47931-85-1 |
| Sequence | {CYS}{SER}{ASN}{LEU}{SER}{THR}{CYS}{VAL}{LEU}{GLY}{LYS}{LEU}{SER}{GLN}{GLU}{LEU}{HIS}{LYS}{LEU}{GLN}{THR}{TYR}{PRO}{ARG}{THR}{ASN}{THR}{GLY}{SER}{GLY}{THR}{PRO}-NH2 |
| Sequence Shortening | CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 |
| Molecular Formula | C145H240N44O48S2 |
| C Terminal | NH2 |
| Disulfide Bridge | Disulfide bridge: Cys1-Cys7 |
| Molecular Weight | 3431.9 |
| Properties | |
| Purity | > 95% |
| Format Bridge | 1-7 |
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. |
| Gmp Flag | 0 |
| Storage | Store at -20°C. |
| Note | Calcitonin is a 32 amino acid polypeptide, 8 of which are conserved across all species. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.