Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Calcitonin, eel
| Overview | |
|---|---|
| Description | Calcitonin is hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. |
| Cas No | 57014-02-5 |
| Sequence | {CYS}{SER}{ASN}{LEU}{SER}{THR}{CYS}{VAL}{LEU}{GLY}{LYS}{LEU}{SER}{GLN}{GLU}{LEU}{HIS}{LYS}{LEU}{GLN}{THR}{TYR}{PRO}{ARG}{THR}{ASP}{VAL}{GLY}{ALA}{GLY}{THR}{PRO}-NH2 |
| Sequence Shortening | CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 |
| Molecular Formula | C146H241N43O47S2 |
| C Terminal | NH2 |
| Disulfide Bridge | Disulfide bridge: Cys1-Cys7 |
| Molecular Weight | 3414.9 |
| Properties | |
| Purity | > 95% |
| Format Bridge | 1-7 |
| Storage | Store at -20°C. Keep tightly closed. Store in a cool dry place. |
| Note | Calcitonin is A 32 amino acid polypeptide, 8 of which are conserved across all species. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.