Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Brain Natriuretic Peptide (BNP) (1-32), rat
| Overview | |
|---|---|
| Synonyms | BNP (1-32), rat |
| Description | Brain natriuretic peptide (type B natriuretic peptide) was originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulation. BNP is involved in blood pressure control and cardiovascular homeostasis. |
| Cas No | 133448-20-1 |
| Sequence | {ASN}{SER}{LYS}{MET}{ALA}{HIS}{SER}{SER}{SER}{CYS}{PHE}{GLY}{GLN}{LYS}{ILE}{ASP}{ARG}{ILE}{GLY}{ALA}{VAL}{SER}{ARG}{LEU}{GLY}{CYS}{ASP}{GLY}{LEU}{ARG}{LEU}{PHE} |
| Sequence Shortening | NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF |
| Molecular Formula | C146H239N47O44S3 |
| Disulfide Bridge | Disulfide bridge: Cys10-Cys26 |
| Molecular Weight | 3452.94 |
| Properties | |
| Purity | > 95% |
| Format Bridge | 10-26 |
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. |
| Gmp Flag | 0 |
| Storage | Store at -20°C. Keep tightly closed. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.