Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Adrenocorticotropic Hormone (ACTH) (1-39), rat
| Overview | |
|---|---|
| Synonyms | ACTH (1-39), ratAdrenocorticotropic hormone, rat |
| Description | Peptide fragments of ACTH (1-39) were formed during in vitro incubation of the peptide with membrane preparations. ACTH (1-39) were isolated by high pressure liquid chromatography, and peptide fragments of ACTH (1-39) characterized by determination of amino acid composition and NH2- terminal residue. |
| Cas No | 77465-10-2 |
| Sequence | {SER}{TYR}{SER}{MET}{GLU}{HIS}{PHE}{ARG}{TRP}{GLY}{LYS}{PRO}{VAL}{GLY}{LYS}{LYS}{ARG}{ARG}{PRO}{VAL}{LYS}{VAL}{TYR}{PRO}{ASN}{VAL}{ALA}{GLU}{ASN}{GLU}{SER}{ALA}{GLU}{ALA}{PHE}{PRO}{LEU}{GLU}{PHE} |
| Sequence Shortening | SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF |
| Molecular Formula | C210H315N57O57S1 |
| Molecular Weight | 4582.5 |
| Properties | |
| Purity | > 95% |
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. |
| Gmp Flag | 0 |
| Storage | Before using, store the peptide in the DRY form at 0-5°C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.